Sale!

Tesamorelin 

$29.99 $24.99

Tesamorelin Peptide 2mg USA

3rd Party Tested

Made in the USA

1 in stock

SKU: PP-TES-22 Category:

Description

Tesamorelin 2mg Peptide USA

Catalog No. OP908

Buy Tesamorelin Peptide 2mg

USA | Growth Hormone Secretagogue

Product Details

Tesamorelin  is a synthetic form of growth-hormone-releasing hormone (GHRH) which is used in the treatment of HIV-associated lipodystrophy. The synthetic peptide consisting of all 44 amino acids of human GHRH with the addition of a trans-3-hexenoic acid group.

Tesamorelin HPLC

Tesa MS


Compound Calculators

 

Specification:

Application
Synthetic form of growth-hormone-releasing hormone
 
CAS 901758-09-6
Molar Mass 5135.86 g/mol
Chemical Formula C221H366N72O67S
Chemical Name (4S)-4-[[2-[[(2S)-5-amino-2-[[(2S)-5-amino-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S,3S)-2-[[(2S)-2-[[(2S)-5-amino-2-[[(2S)-2-[[(2S)-2-[[(2S)-6-amino-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-5-amino-2-[[2-[[(2S)-2-[[(2S)-2-[[(2S)-6-amino-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-4-amino-2-[[(2S,3R)-2-[[(2S)-2-[[(2S,3S)-2-[[(2S)-2-[[(2S)-3-carboxy-2-[[(2S)-2-[[(2S)-2-[[(E)-hex-3-enoyl]amino]-3-(4-hydroxyphenyl)propanoyl]amino]propanoyl]amino]propanoyl]amino]propanoyl]amino]-3-methylpentanoyl]amino]-3-phenylpropanoyl]amino]-3-hydroxybutanoyl]amino]-4-oxobutanoyl]amino]-3-hydroxypropanoyl]amino]-3-(4-hydroxyphenyl)propanoyl]amino]-5-carbamimidamidopentanoyl]amino]hexanoyl]amino]-3-methylbutanoyl]amino]-4-methylpentanoyl]amino]acetyl]amino]-5-oxopentanoyl]amino]-4-methylpentanoyl]amino]-3-hydroxypropanoyl]amino]propanoyl]amino]-5-carbamimidamidopentanoyl]amino]hexanoyl]amino]-4-methylpentanoyl]amino]-4-methylpentanoyl]amino]-5-oxopentanoyl]amino]-3-carboxypropanoyl]amino]-3-methylpentanoyl]amino]-4-methylsulfanylbutanoyl]amino]-3-hydroxypropanoyl]amino]-5-carbamimidamidopentanoyl]amino]-5-oxopentanoyl]amino]-5-oxopentanoyl]amino]acetyl]amino]-5-[[(2S)-1-[[(2S)-4-amino-1-[[(2S)-5-amino-1-[[(2S)-1-[[(2S)-1-[[2-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-amino-4-methyl-1-oxopentan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-1-oxopropan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-1-oxopropan-2-yl]amino]-2-oxoethyl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-4-carboxy-1-oxobutan-2-yl]amino]-1,5-dioxopentan-2-yl]amino]-1,4-dioxobutan-2-yl]amino]-3-hydroxy-1-oxopropan-2-yl]amino]-5-oxopentanoic acid
Synonyms

UNII-MQG94M5EEO

MQG94M5EEO

TH9507

Egrifta

Tesamorelin [USAN:INN]

TH 9507

UNII-LGW5H38VE3 component QBEPNUQJQWDYKU-BMGKTWPMSA-N

804475-66-9

Solubility It is recommended to reconstitute the lyophilized  in sterile bacteriostatic H2O , which can then be diluted to for various aqueous solutions.
Stability water, DMSO, Ethanol
Shipping Temp Room Temp
Physical Form Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
The products we offer are intended for laboratory research use only. Before you order, please read and fully understand our Terms & Conditions. THIS PRODUCT IS NOT INTENDED TO TREAT, CURE OR DIAGNOSE ANY CONDITION OR DISEASE AND IS NOT FOR HUMAN CONSUMPTION

 

Additional information

Weight .04 lbs
Dimensions 1.2 × 1.2 × 3 in

Reviews

There are no reviews yet.

Only logged in customers who have purchased this product may leave a review.